PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3KG134900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 226aa    MW: 26468.2 Da    PI: 5.1933
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3KG134900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS1993e-613217159374
                 GRAS 159 eetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh 248
                           +tg+rL+++Ae ++vpf+++  +a+r+e++ +e+L+++++E+l+Vn+++q ++l de+ +++s+rd+vL+++k+++P+v+++   +  +
  Pavir.3KG134900.1.p   3 DATGKRLTEYAEMFHVPFQYQG-IASRWENICTEDLNIDKDEVLIVNCMYQTKYLGDETEDIDSARDRVLRIMKKINPEVFILGIINGFY 91 
                          689*******************.7****************************************************************** PP

                 GRAS 249 nsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqak 338
                          ns+ Fl rf e l +ys+lfd++++ +++++e+ri +Er llg ++ nvvacegaer+er et+++W++r  +aGFk++p+++ + k   
  Pavir.3KG134900.1.p  92 NSPFFLPRFREVLFHYSSLFDMYNTIVAQNDEARILIERDLLGTDVLNVVACEGAERIERPETYKQWQARSLKAGFKQLPVNQAILKRSI 181
                          *************************************************************************************99887 PP

                 GRAS 339 lllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                             +k + d + ++e++g+l++gWk+r +++vS+W+
  Pavir.3KG134900.1.p 182 DEKKKNYHDDFVINEDNGWLLQGWKGRIMYAVSSWK 217
                          7777777788*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098532.8241197IPR005202Transcription factor GRAS
PfamPF035141.0E-583217IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MIDATGKRLT EYAEMFHVPF QYQGIASRWE NICTEDLNID KDEVLIVNCM YQTKYLGDET  60
EDIDSARDRV LRIMKKINPE VFILGIINGF YNSPFFLPRF REVLFHYSSL FDMYNTIVAQ  120
NDEARILIER DLLGTDVLNV VACEGAERIE RPETYKQWQA RSLKAGFKQL PVNQAILKRS  180
IDEKKKNYHD DFVINEDNGW LLQGWKGRIM YAVSSWKPKE QYSNQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-192217160375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012700241.11e-136PREDICTED: scarecrow-like protein 9
SwissprotO809333e-87SCL9_ARATH; Scarecrow-like protein 9
TrEMBLK3ZDU31e-136K3ZDU3_SETIT; Uncharacterized protein
STRINGSi024734m1e-135(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP150538118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.12e-88GRAS family protein